AlphaFold
Introduction#
AlphaFold is an artificial intelligence (AI) system developed by Google DeepMind for predicting protein structures. Using deep learning, AlphaFold's accuracy matches that of traditional experimental techniques at a fraction of the cost and in less time. This document provides guidelines for installing and running AlphaFold in user space on Sherlock.
Boltz
Boltz is an open-source AI model released by MIT, designed to accurately model complex biomolecular interactions, and that achieves state-of-the-art performance at the level of AlphaFold 3.
To access Boltz on Sherlock, you can simply load the py-boltz module, in the biology category, and start predicting structures:
$ ml biology py-boltz
$ boltz predict <input_path> --use_msa_server
AlphaFold 3 on Sherlock#
Installing AlphaFold 3#
Requesting model parameters#
Access to AlphaFold 3 model parameters is granted at the discretion of Google DeepMind and is subject to their Terms of Use. Each user must request their own copy of the model parameters. Researchers can complete the request form found here.
Personal Gmail address only
When filling out the request form, you must use a personal Gmail address for the Google account email address field. Your Stanford email address will not work and your request will be rejected.
Downloading model parameters#
Once your access is approved by Google DeepMind, you will receive a link to download the model parameters file, af3.bin.zst. It is recommended to download the model parameters to $HOME. The file is ~1 GB in size.
$ mkdir $HOME/af3_model
$ cd $HOME/af3_model
$ wget <personal_download_link>
You can make a copy of your model parameters to $SCRATCH, which will have faster performance when running AlphaFold 3.
$ cp -R $HOME/af3_model $SCRATCH
Copying the databases#
For faster performance, you will need a copy of the AlphaFold 3 databases in $SCRATCH or $GROUP_SCRATCH. Stanford Research Computing maintains a copy in the Common Datasets repository. You can use the following template to create a batch job for copying the databases.
#!/bin/bash
#SBATCH --ntasks=4
#SBATCH --partition=service
#SBATCH --time=6:00:00
ml system mpifileutils
srun dcp $COMMON_DATASETS/alphafold3 $SCRATCH/af3_db
Unmodified files are purged from $SCRATCH and $GROUP_SCRATCH every 90 days. As you run AlphaFold, you can include a dsync in your scripts that compares your $SCRATCH databases with those in $COMMON_DATASETS/alphafold3 and automatically copies over any missing files (shown in the example scripts below).
Getting the Apptainer image#
Container software like Apptainer allow researchers to easily "contain" or package software and port it between compute platforms. Stanford Research Computing provides a container for the latest stable release of AlphaFold 3. However, if you would like to use the most recent development version of AlphaFold 3, you can follow the instructions below for building your own container.
To copy the prebuilt container for AlphaFold 3:
$ cp /home/groups/sh_support/share/containers/af3_v301.sif $SCRATCH/af3_v301.sif
Check for the latest version
The container filename above may not reflect the latest available version. Run ls /home/groups/sh_support/share/containers/af3_*.sif to see what is currently available.
To build your own container:
$ sh_dev -m 12GB
$ mkdir -p $GROUP_HOME/$USER
$ cd $GROUP_HOME/$USER
$ git clone https://github.com/google-deepmind/alphafold3.git
$ cd alphafold3
$ wget https://raw.githubusercontent.com/google-deepmind/alphafold3/main/docker/jackhmmer_seq_limit.patch
$ apptainer build af3_dev.sif /home/groups/sh_support/share/containers/alphafold/af3_dev.def
$ exit
After you have created the af3_dev.sif file, you should put a copy of it in $SCRATCH or $GROUP_SCRATCH.
And that's it! Once you have the model parameters, databases, and Apptainer image, you are ready to start running AlphaFold 3 on Sherlock.
Using AlphaFold 3#
Setting up input and output directories#
Create directories for AlphaFold 3 inputs and outputs in $SCRATCH or $GROUP_SCRATCH.
$ mkdir -p $SCRATCH/af_input
$ mkdir -p $SCRATCH/af_output
AlphaFold 3 takes .json files as input, describing the sequences you want to fold. For the full input format specification, see the AlphaFold 3 input documentation. Here is a minimal example for a single protein chain:
{
"name": "my_protein",
"modelSeeds": [1],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "MGYINVVKDMTQNLRSLLNLLDKKVTSGLGASEVDGQLISLRGAGQFPASQASNSS"
}
}
],
"dialect": "alphafold3",
"version": 1
}
Save the file in your af_input directory. The name field determines the name of the output sub-directory.
Running the data pipeline#
Running AlphaFold 3 can be broken down into two parts: pipeline and inference. The pipeline refers to the genetic sequence search/template search, and inference refers to predicting structures. GPUs are only utilized during inference, so we are going to run the pipeline on CPUs. You can use the following batch script as a template.
In order to run the pipeline step on a particular sequence, the bash variable INPUT_JSON needs to be set to the filename of the input .json file you would like to fold, and the .json file needs to be placed in the af_input directory. In the template below the example input file is fold_input_2PV7.json.
#!/bin/bash
#SBATCH --partition=normal
#SBATCH --cpus-per-task=8
#SBATCH --mem=20G
#SBATCH --time=0-01:00:00
### Uncomment to sync missing database files from Oak before running
# rsync -a $COMMON_DATASETS/alphafold3/ $SCRATCH/af3_db/
# model and database paths variables
SIF_FILE=af3_dev.sif
MODEL_PARAMS_PATH=$SCRATCH/af3_model
DB_PATH=$SCRATCH/af3_db
INPUT_JSON=fold_input_2PV7.json
# run alphafold3 apptainer container
apptainer run \
--nv \
--bind $SCRATCH/af_input:/root/af_input \
--bind $SCRATCH/af_output:/root/af_output \
--bind $MODEL_PARAMS_PATH:/root/models \
--bind $DB_PATH:/root/public_databases \
$SIF_FILE \
--norun_inference \
--json_path=/root/af_input/$INPUT_JSON \
--model_dir=/root/models \
--db_dir=/root/public_databases \
--output_dir=/root/af_output
8 CPUs is the sweet spot for the data pipeline
AlphaFold 3 uses jackhmmer and nhmmer for sequence searches, which are capped at 8 CPUs. Going beyond 8 provides almost no additional speedup. If you do change --cpus-per-task, pass the matching values explicitly with --jackhmmer_n_cpu=<N> and --nhmmer_n_cpu=<N>.
Running inference#
AlphaFold 3 runs best on GPUs with CUDA Capability > 7.x. When writing your batch script for inference, you should include a constraint for the GPU type. You can use the following batch script as a template.
In order to run the inference step on your particular sequence of interest, you will need to modify the bash variable DATA_JSON with the directory and filename of the data .json file created during the pipeline step. The data directory and file are located in your af_output directory. In the template example below the data directory and file is /2pv7/2pv7_data.json.
#!/bin/bash
#SBATCH --partition=gpu
#SBATCH --cpus-per-task=8
#SBATCH --mem=20G
#SBATCH --gpus=1
#SBATCH --constraint=GPU_SKU:H100_SXM5
#SBATCH --time=0-00:10:00
### Uncomment to sync missing database files from Oak before running
# rsync -a $COMMON_DATASETS/alphafold3/ $SCRATCH/af3_db/
# model and database paths variables
SIF_FILE=af3_dev.sif
MODEL_PARAMS_PATH=$SCRATCH/af3_model
DB_PATH=$SCRATCH/af3_db
DATA_JSON=/2pv7/2pv7_data.json
# JAX compilation cache (avoids recompiling kernels on every run)
CACHE_DIR=$SCRATCH/.cache/jax
mkdir -p $CACHE_DIR
# run alphafold3 apptainer container
apptainer run \
--nv \
--env JAX_TRACEBACK_FILTERING=off \
--env XLA_FLAGS="--xla_gpu_enable_triton_gemm=false" \
--env JAX_COMPILATION_CACHE_DIR=/root/.cache/jax \
--bind $SCRATCH/af_input:/root/af_input \
--bind $SCRATCH/af_output:/root/af_output \
--bind $MODEL_PARAMS_PATH:/root/models \
--bind $DB_PATH:/root/public_databases \
--bind $CACHE_DIR:/root/.cache/jax \
$SIF_FILE \
--norun_data_pipeline \
--json_path=/root/af_output/$DATA_JSON \
--model_dir=/root/models \
--output_dir=/root/af_output
Out of GPU memory on large inputs?
For very long sequences or large complexes (roughly >5,000 tokens), inference may run out of GPU memory. You can enable JAX unified memory to spill overflow to system RAM by adding --env XLA_PYTHON_CLIENT_ALLOCATOR=platform to your apptainer run command. This allows larger inputs to run at the cost of some performance.
Chaining pipeline and inference jobs#
Rather than waiting for the pipeline job to finish before submitting inference, you can use the --dependency option to submit both jobs upfront and have inference start automatically once the pipeline succeeds.
# Submit the pipeline job and capture its job ID
PIPELINE_JOB=$(sbatch --parsable run_pipeline.sh)
# Submit inference to run only after the pipeline job completes successfully
sbatch --dependency=afterok:$PIPELINE_JOB run_inference.sh
If the pipeline job fails, the dependent inference job will not start. You can cancel it with scancel <inference_job_id>.
Understanding the output#
After running both steps, your af_output directory will contain a sub-directory named after the name field in your input JSON. Its contents after a full run look like this:
af_output/
└── my_protein/
├── my_protein_data.json # intermediate output from the pipeline step
├── my_protein_model.cif # best predicted structure
├── my_protein_confidences.json # per-residue confidence scores (pLDDT, PAE)
├── my_protein_summary_confidences.json
├── ranking_scores.csv # ranking of all generated samples
├── seed-1_sample-0/
│ ├── model.cif
│ ├── confidences.json
│ └── summary_confidences.json
├── seed-1_sample-1/
...
└── TERMS_OF_USE.md
By default, AlphaFold 3 generates 5 samples per seed. The top-ranked structure is copied to my_protein_model.cif at the top level.
Best Practices#
Maintaining databases with dsync#
Stanford Research Computing maintains a copy of the AlphaFold 3 databases in the Common Datasets repository, so you don't need to download them from Google DeepMind yourself. Since unmodified files in $SCRATCH and $GROUP_SCRATCH are purged every 90 days, you can use dsync to periodically re-sync your local copy from Oak, transferring only files that are missing or outdated.
$ module load system mpifileutils
$ srun dsync --quiet $COMMON_DATASETS/alphafold3 $SCRATCH/af3_db
Note that running dsync will increase the runtime of your job depending on how many files need to be re-copied. You can also run it separately and periodically from its own sbatch script.
JAX compilation cache#
On its first run, AlphaFold 3 compiles GPU kernels via XLA, which can take several minutes. By pointing the compilation cache to $SCRATCH, subsequent runs reuse the compiled kernels and start significantly faster. The inference script above already sets this up — just make sure CACHE_DIR points to a consistent location across runs.
If you are running multiple jobs in parallel, they can safely share the same cache directory.
GPU selection#
The Apptainer container has been tested extensively on Sherlock GPUs with CUDA capability 8.x or higher. These include H100, L40S, RTX 3090, A100, and A40 model GPUs. New models, such as the H100 and L40S, produce the fastest run times, with older models taking slightly longer. Consumer grade GPUs, such as the RTX 3090, are also sequence limited due to lower GPU memory.
To run exclusively on a particular GPU model, you can use the SLURM --constraint option. This option takes a node's feature as an argument and sets it as a requirement of the job. Use the Sherlock utility sh_node_feat -h to see a list of available node features.
Multiple job constraints can also be specified with AND (&) and OR (|) operators. For example, if you are submitting an inference job to the queue and want to run from a larger pool of GPU resources, you can specify both H100 or L40S GPUs:
#SBATCH --constraint="GPU_SKU:H100_SXM5|GPU_SKU:L40S"
Additionally, the compute capability is also listed as a node feature, and you can specify it directly as a constraint. For example, you can specify compute capabilities 8.9 or 9.0 with:
#SBATCH --constraint="GPU_CC:8.9|GPU_CC:9.0"
Successful inference runs on GPUs with CUDA capability 7.x or lower are limited by sequence length and GPU memory. If you do wish to run an inference job on an older GPU, the Apptainer container contains logic to test for the compute capability of the available GPU and set the appropriate environmental variables before running AlphaFold 3. A successful run, however, is not guaranteed. To specify a particular GPU use the SLURM --constraint option mentioned above.
Notes on Apptainer containers#
On Sherlock, the preferred method for running AlphaFold 3 is from an Apptainer container. The definition file (af3_dev.def) provided by SRC is modified from the Dockerfile that Google DeepMind publishes with AlphaFold 3. It takes into account the heterogeneity of the Sherlock cluster, and provides logic to determine which environment variables need to be set based on the compute capability of the available GPU.
AlphaFold 3 reads and writes to several directories during runtime such as af_input, af_output, af3_model, and af3_db. In order to run from a container, the necessary directories on Sherlock's filesystem need to be bound to the filesystem within the container; this is the purpose of the --bind flags in the sbatch scripts above.
The container runs AlphaFold 3 using the %runscript section. The contents of the %runscript section are executed when the container image is run with apptainer run. This is different from the typical usage of Apptainer containers, where software within the container is explicitly called during runtime.